PIP5KL1 antibody (70R-2043)

Rabbit polyclonal PIP5KL1 antibody raised against the middle region of PIP5KL1

Synonyms Polyclonal PIP5KL1 antibody, Anti-PIP5KL1 antibody, Phosphatidylinositol-4-Phosphate 5-Kinase-Like 1 antibody, PIP5KL1, MGC46424 antibody, PIPKL1 5 antibody, bA203J24.5 antibody, PIPKH antibody, RP11-203J24.5 antibody, PIPKL1-5 antibody, PIPKL1 5, PIPKL1-5
Specificity PIP5KL1 antibody was raised against the middle region of PIP5KL1
Cross Reactivity Human
Applications WB
Immunogen PIP5KL1 antibody was raised using the middle region of PIP5KL1 corresponding to a region with amino acids VLDYSLLIAFQRLHEDERGPGSSLIFRTARSVQGAQSPEESRAQNRRLLP
Assay Information PIP5KL1 Blocking Peptide, catalog no. 33R-9646, is also available for use as a blocking control in assays to test for specificity of this PIP5KL1 antibody

Images

Western Blot analysis using PIP5KL1 antibody (70R-2043)

PIP5KL1 antibody (70R-2043) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIP5KL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PIP5KL1 may act as a scaffold to localize and regulate type I PI(4)P 5-kinases to specific compartments within the cell, where they generate PI(4,5)P2 for actin nucleation, signaling and scaffold protein recruitment and conversion to PI(3,4,5)P3.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PIP5KL1 antibody (70R-2043) | PIP5KL1 antibody (70R-2043) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors