PITPNB antibody (70R-3120)

Rabbit polyclonal PITPNB antibody raised against the middle region of PITPNB

Synonyms Polyclonal PITPNB antibody, Anti-PITPNB antibody, PI-TP-beta antibody, VIB1B antibody, Phosphatidylinositol Transfer Protein Beta antibody, PtdInsTP antibody
Specificity PITPNB antibody was raised against the middle region of PITPNB
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PITPNB antibody was raised using the middle region of PITPNB corresponding to a region with amino acids ADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAY
Assay Information PITPNB Blocking Peptide, catalog no. 33R-1104, is also available for use as a blocking control in assays to test for specificity of this PITPNB antibody


Western Blot analysis using PITPNB antibody (70R-3120)

PITPNB antibody (70R-3120) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PITPNB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PITPNB is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PITPNB antibody (70R-3120) | PITPNB antibody (70R-3120) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors