PIWIL1 antibody (70R-2538)

Rabbit polyclonal PIWIL1 antibody

Synonyms Polyclonal PIWIL1 antibody, Anti-PIWIL1 antibody, PIWIL 1 antibody, PIWIL 1, Piwi-Like 1 antibody, PIWI antibody, PIWIL-1, PIWIL-1 antibody, HIWI antibody, PIWIL1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PIWIL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYY
Assay Information PIWIL1 Blocking Peptide, catalog no. 33R-5494, is also available for use as a blocking control in assays to test for specificity of this PIWIL1 antibody


Western Blot analysis using PIWIL1 antibody (70R-2538)

PIWIL1 antibody (70R-2538) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 98 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIWIL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PIWIL1 is a member of the PIWI subfamily of Argonaute proteins, evolutionarily conserved proteins containing both PAZ and Piwi motifs that play important roles in stem cell self-renewal, RNA silencing, and translational regulation in diverse organisms. PIWIL1 may play a role as an intrinsic regulator of the self-renewal capacity of germline and hematopoietic stem cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PIWIL1 antibody (70R-2538) | PIWIL1 antibody (70R-2538) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors