PIWIL2 antibody (70R-2277)

Rabbit polyclonal PIWIL2 antibody

Synonyms Polyclonal PIWIL2 antibody, Anti-PIWIL2 antibody, PIWIL-2 antibody, FLJ10351 antibody, PIWIL 2, PIWIL-2, PIWIL2, MGC133049 antibody, Piwi-Like 2 antibody, mili antibody, HILI antibody, PIWIL1L antibody, PIWIL 2 antibody
Cross Reactivity Human
Applications WB
Immunogen PIWIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM
Assay Information PIWIL2 Blocking Peptide, catalog no. 33R-7778, is also available for use as a blocking control in assays to test for specificity of this PIWIL2 antibody

Images

Western Blot analysis using PIWIL2 antibody (70R-2277)

PIWIL2 antibody (70R-2277) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 110 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIWIL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PIWIL2 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PIWIL2 antibody (70R-2277) | PIWIL2 antibody (70R-2277) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors