PIWIL2 Blocking Peptide (33R-7778)

A synthetic peptide for use as a blocking control in assays to test for specificity of PIWIL2 antibody, catalog no. 70R-2277

Synonyms PIWIL2 control peptide, PIWIL2 antibody Blocking Peptide, Anti-PIWIL2 Blocking Peptide, Piwi-Like 2 Blocking Peptide, FLJ10351 Blocking Peptide, HILI Blocking Peptide, MGC133049 Blocking Peptide, PIWIL1L Blocking Peptide, mili Blocking Peptide, PIWIL2, PIWIL-2, PIWIL 2, PIWIL-2 Blocking Peptide, PIWIL 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM
Molecular Weight 110 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PIWIL2 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors