PIWIL2 Blocking Peptide (33R-7778)
A synthetic peptide for use as a blocking control in assays to test for specificity of PIWIL2 antibody, catalog no. 70R-2277
Overview
Overview
| Synonyms | PIWIL2 control peptide, PIWIL2 antibody Blocking Peptide, Anti-PIWIL2 Blocking Peptide, Piwi-Like 2 Blocking Peptide, FLJ10351 Blocking Peptide, HILI Blocking Peptide, MGC133049 Blocking Peptide, PIWIL1L Blocking Peptide, mili Blocking Peptide, PIWIL2, PIWIL-2, PIWIL 2, PIWIL-2 Blocking Peptide, PIWIL 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM |
|---|---|
| Molecular Weight | 110 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PIWIL2 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product