PIWIL4 antibody (70R-2275)

Rabbit polyclonal PIWIL4 antibody

Synonyms Polyclonal PIWIL4 antibody, Anti-PIWIL4 antibody, DKFZp686P01248 antibody, FLJ36156 antibody, HIWI2 antibody, PIWIL4, PIWIL 4, Piwi-Like 4 antibody, PIWIL-4 antibody, PIWIL 4 antibody, PIWIL-4
Cross Reactivity Human
Applications WB
Immunogen PIWIL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLS
Assay Information PIWIL4 Blocking Peptide, catalog no. 33R-5441, is also available for use as a blocking control in assays to test for specificity of this PIWIL4 antibody

Images

Western Blot analysis using PIWIL4 antibody (70R-2275)

PIWIL4 antibody (70R-2275) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 96 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIWIL4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PIWIL4 antibody (70R-2275) | PIWIL4 antibody (70R-2275) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors