PIWIL4 Blocking Peptide (33R-8482)

A synthetic peptide for use as a blocking control in assays to test for specificity of PIWIL4 antibody, catalog no. 70R-2276

Synonyms PIWIL4 control peptide, PIWIL4 antibody Blocking Peptide, Anti-PIWIL4 Blocking Peptide, Piwi-Like 4 Blocking Peptide, DKFZp686P01248 Blocking Peptide, FLJ36156 Blocking Peptide, HIWI2 Blocking Peptide, PIWIL4, PIWIL-4, PIWIL 4, PIWIL-4 Blocking Peptide, PIWIL 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSR
Molecular Weight 96 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors