PIWIL4 Blocking Peptide (33R-8482)
A synthetic peptide for use as a blocking control in assays to test for specificity of PIWIL4 antibody, catalog no. 70R-2276
Overview
Overview
| Synonyms | PIWIL4 control peptide, PIWIL4 antibody Blocking Peptide, Anti-PIWIL4 Blocking Peptide, Piwi-Like 4 Blocking Peptide, DKFZp686P01248 Blocking Peptide, FLJ36156 Blocking Peptide, HIWI2 Blocking Peptide, PIWIL4, PIWIL-4, PIWIL 4, PIWIL-4 Blocking Peptide, PIWIL 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSR |
|---|---|
| Molecular Weight | 96 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product