PKLR antibody (70R-1230)

Rabbit polyclonal PKLR antibody raised against the N terminal of PKLR

Synonyms Polyclonal PKLR antibody, Anti-PKLR antibody, RPK antibody, PKL antibody, Pyruvate Kinase Liver And Rbc antibody, PK1 antibody
Specificity PKLR antibody was raised against the N terminal of PKLR
Cross Reactivity Human,Mouse,Rat,Dog,C.elegans
Applications IHC, WB
Immunogen PKLR antibody was raised using the N terminal of PKLR corresponding to a region with amino acids STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE
Assay Information PKLR Blocking Peptide, catalog no. 33R-8888, is also available for use as a blocking control in assays to test for specificity of this PKLR antibody


Immunohistochemical staining using PKLR antibody (70R-1230)

PKLR antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PKLR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PKLR is a pyruvate kinase that catalyzes the production of phohsphoenolpyruvate from pyruvate and ATP. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using PKLR antibody (70R-1230) | PKLR antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using PKLR antibody (70R-1230) | PKLR antibody (70R-1230) used at 5 ug/ml to detect target protein.
  • Immunohistochemical staining using PKLR antibody (70R-1230) | PKLR antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors