PLA2G4E antibody (70R-4051)

Rabbit polyclonal PLA2G4E antibody raised against the c terminal of PLA2G4E

Synonyms Polyclonal PLA2G4E antibody, Anti-PLA2G4E antibody, PLAG4E-2 antibody, MGC126661 antibody, PLAG4E 2 antibody, PLAG4E 2, Phospholipase A2 Group Ive antibody, FLJ45651 antibody, MGC126633 antibody, PLAG4E-2, PLA2G4E
Specificity PLA2G4E antibody was raised against the c terminal of PLA2G4E
Cross Reactivity Human
Applications WB
Immunogen PLA2G4E antibody was raised using the C terminal of PLA2G4E corresponding to a region with amino acids TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT
Assay Information PLA2G4E Blocking Peptide, catalog no. 33R-9063, is also available for use as a blocking control in assays to test for specificity of this PLA2G4E antibody


Western Blot analysis using PLA2G4E antibody (70R-4051)

PLA2G4E antibody (70R-4051) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 96 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLA2G4E antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PLA2G4E is a calcium-dependent phospholipase A2 that selectively hydrolyzes glycerophospholipids in the sn-2 position.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PLA2G4E antibody (70R-4051) | PLA2G4E antibody (70R-4051) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors