Plasminogen antibody (70R-5384)

Rabbit polyclonal Plasminogen antibody raised against the middle region of PLG

Synonyms Polyclonal Plasminogen antibody, Anti-Plasminogen antibody, PLG antibody, DKFZp779M0222 antibody
Specificity Plasminogen antibody was raised against the middle region of PLG
Cross Reactivity Human
Applications WB
Immunogen Plasminogen antibody was raised using the middle region of PLG corresponding to a region with amino acids LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
Assay Information Plasminogen Blocking Peptide, catalog no. 33R-5066, is also available for use as a blocking control in assays to test for specificity of this Plasminogen antibody


Western Blot analysis using Plasminogen antibody (70R-5384)

Plasminogen antibody (70R-5384) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 88 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a secreted blood zymogen that is activated by proteolysis and converted to plasmin and angiostatin.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Plasminogen antibody (70R-5384) | Plasminogen antibody (70R-5384) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors