Plastin 3 antibody (70R-3756)

Rabbit polyclonal Plastin 3 antibody

Synonyms Polyclonal Plastin 3 antibody, Anti-Plastin 3 antibody, Plastin 3, Plastin 3 antibody, T-plastin antibody, PLS3 antibody, Plastin -3, Plastin 3, Plastin -3 antibody
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen Plastin 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSS
Assay Information Plastin 3 Blocking Peptide, catalog no. 33R-8170, is also available for use as a blocking control in assays to test for specificity of this Plastin 3 antibody


Western Blot analysis using Plastin 3 antibody (70R-3756)

Plastin 3 antibody (70R-3756) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLS3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Plastin 3 antibody (70R-3756) | Plastin 3 antibody (70R-3756) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors