PLCD1 antibody (70R-5852)

Rabbit polyclonal PLCD1 antibody raised against the N terminal of PLCD1

Synonyms Polyclonal PLCD1 antibody, Anti-PLCD1 antibody, PLCD 1, PLCD1, PLCD-1 antibody, PLCD 1 antibody, Phospholipase C Delta 1 antibody, PLCD-1
Specificity PLCD1 antibody was raised against the N terminal of PLCD1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PLCD1 antibody was raised using the N terminal of PLCD1 corresponding to a region with amino acids DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH
Assay Information PLCD1 Blocking Peptide, catalog no. 33R-2003, is also available for use as a blocking control in assays to test for specificity of this PLCD1 antibody


Western Blot analysis using PLCD1 antibody (70R-5852)

PLCD1 antibody (70R-5852) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 86 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLCD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Phosphoinositide-specific phospholipase C (PLC) acts as a signal transducer that generates 2 second messengers, diacylglycerol and inositol 1,4,5-trisphosphate, by hydrolyzing inositol phospholipids. PLC comprises a diverse family of enzymes that differ in structure and tissue distribution.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PLCD1 antibody (70R-5852) | PLCD1 antibody (70R-5852) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors