PLEKHO1 antibody (70R-4482)

Rabbit polyclonal PLEKHO1 antibody raised against the N terminal of PLEKHO1

Synonyms Polyclonal PLEKHO1 antibody, Anti-PLEKHO1 antibody, PLEKHO1, RP11-458I7.3 antibody, Pleckstrin Homology Domain Containing Family O Member 1 antibody, PLEKHO 1, PLEKHO-1, CKIP-1 antibody, PLEKHO-1 antibody, OC120 antibody, PLEKHO 1 antibody
Specificity PLEKHO1 antibody was raised against the N terminal of PLEKHO1
Cross Reactivity Human
Applications WB
Immunogen PLEKHO1 antibody was raised using the N terminal of PLEKHO1 corresponding to a region with amino acids MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKG
Assay Information PLEKHO1 Blocking Peptide, catalog no. 33R-6233, is also available for use as a blocking control in assays to test for specificity of this PLEKHO1 antibody


Western Blot analysis using PLEKHO1 antibody (70R-4482)

PLEKHO1 antibody (70R-4482) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLEKHO1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PLEKHO1 plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP).PLEKHO1 may function to target CK2 to the plasma membrane thereby serving as an adapter to facilitate the phosphorylation of CP by protein kinase 2 (CK2). PLEKHO1 appears to target ATM to the plasma membrane. PLEKHO1 appears to also inhibit tumor cell growth by inhibiting AKT-mediated cell-survival. PLEKHO1 is also implicated in PI3K-regulated muscle differentiation, the regulation of AP-1 activity (plasma membrane bound AP-1 regulator that translocates to the nucleus) and the promotion of apoptosis induced by tumor necrosis factor TNF. When bound to PKB, it inhibits it probably by decreasing PKB level of phosphorylation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PLEKHO1 antibody (70R-4482) | PLEKHO1 antibody (70R-4482) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors