PLK1 antibody (70R-5563)

Rabbit polyclonal PLK1 antibody

Synonyms Polyclonal PLK1 antibody, Anti-PLK1 antibody, PLK 1 antibody, PLK1, Polo-Like Kinase 1 antibody, PLK-1, PLK-1 antibody, PLK 1, STPK13 antibody, PLK antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen PLK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS
Assay Information PLK1 Blocking Peptide, catalog no. 33R-4619, is also available for use as a blocking control in assays to test for specificity of this PLK1 antibody


Western blot analysis using PLK1 antibody (70R-5563)

Recommended PLK1 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Serine/threonine-protein kinase that performs several important functions throughout M phase of the cell cycle, including the regulation of centrosome maturation and spindle assembly, the removal of cohesins from chromosome arms, the inactivation of APC/C inhibitors, and the regulation of mitotic exit and cytokinesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using PLK1 antibody (70R-5563) | Recommended PLK1 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using PLK1 antibody (70R-5563) | Testis

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors