PM20D2 antibody (70R-4116)

Rabbit polyclonal PM20D2 antibody raised against the middle region of PM20D2

Synonyms Polyclonal PM20D2 antibody, Anti-PM20D2 antibody, bA63L7.3 antibody, PMD2 20, PMD2-20 antibody, PMD2-20, ACY1L2 antibody, PM20D2, PMD2 20 antibody, Peptidase M20 Domain Containing 2 antibody
Specificity PM20D2 antibody was raised against the middle region of PM20D2
Cross Reactivity Human,Rat
Applications WB
Immunogen PM20D2 antibody was raised using the middle region of PM20D2 corresponding to a region with amino acids HGIIKNGGVKPNIIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALAS
Assay Information PM20D2 Blocking Peptide, catalog no. 33R-3738, is also available for use as a blocking control in assays to test for specificity of this PM20D2 antibody


Western Blot analysis using PM20D2 antibody (70R-4116)

PM20D2 antibody (70R-4116) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PM20D2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PM20D2 belongs to the peptidase M20A family. The function of PM20D2 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PM20D2 antibody (70R-4116) | PM20D2 antibody (70R-4116) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors