PMM1 antibody (70R-3894)

Rabbit polyclonal PMM1 antibody raised against the N terminal of PMM1

Synonyms Polyclonal PMM1 antibody, Anti-PMM1 antibody, PMM 1, PMM-1 antibody, PMM 1 antibody, PMM-1, Sec53 antibody, PMM1, Phosphomannomutase 1 antibody
Specificity PMM1 antibody was raised against the N terminal of PMM1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PMM1 antibody was raised using the N terminal of PMM1 corresponding to a region with amino acids MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGV
Assay Information PMM1 Blocking Peptide, catalog no. 33R-5802, is also available for use as a blocking control in assays to test for specificity of this PMM1 antibody

Images

Western Blot analysis using PMM1 antibody (70R-3894)

PMM1 antibody (70R-3894) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PMM1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Phosphomannomutase catalyzes the conversion between D-mannose 6-phosphate and D-mannose 1-phosphate which is a substrate for GDP-mannose synthesis. GDP-mannose is used for synthesis of dolichol-phosphate-mannose, which is essential for N-linked glycosylat

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PMM1 antibody (70R-3894) | PMM1 antibody (70R-3894) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors