PNMA3 Blocking Peptide (33R-7985)

A synthetic peptide for use as a blocking control in assays to test for specificity of PNMA3 antibody, catalog no. 70R-3050

Synonyms PNMA3 control peptide, PNMA3 antibody Blocking Peptide, Anti-PNMA3 Blocking Peptide, Paraneoplastic Antigen Ma3 Blocking Peptide, MA3 Blocking Peptide, MA5 Blocking Peptide, MGC132756 Blocking Peptide, MGC132758 Blocking Peptide, PNMA3, PNMA-3, PNMA 3, PNMA-3 Blocking Peptide, PNMA 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSRGSRKR
Molecular Weight 52 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the paraneoplastic antigen MA (PNMA) gene family, whose protein products share homology with retroviral Gag proteins. They are highly expressed in the brain and also in a range of tumors associated with serious neurological phenotypes. PMID:16407312 reports the presence of a functional -1 ribosomal frameshift signal (consisting of a heptanucleotide shift motif followed 3' by a pseudoknot structure) in this gene, however, the frame-shifted product has not been characterized.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors