POLL Blocking Peptide (33R-8621)

A synthetic peptide for use as a blocking control in assays to test for specificity of POLL antibody, catalog no. 70R-5637

Synonyms POLL control peptide, POLL antibody Blocking Peptide, Anti-POLL Blocking Peptide, Polymerase (DNA directed) lambda Blocking Peptide, BETA-N Blocking Peptide, FLJ46002 Blocking Peptide, POL-KAPPA Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW
Molecular Weight 63 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance POLL is a repair polymerase.It is involved in base excision repair (BER) responsible for repair of lesions that give rise to abasic (AP) sites in DNA. Has both DNA polymerase and terminal transferase activities. Has a 5'-deoxyribose-5-phosphate lyase (dRP lyase) activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors