POLL Blocking Peptide (33R-8621)
A synthetic peptide for use as a blocking control in assays to test for specificity of POLL antibody, catalog no. 70R-5637
Overview
Overview
| Synonyms | POLL control peptide, POLL antibody Blocking Peptide, Anti-POLL Blocking Peptide, Polymerase (DNA directed) lambda Blocking Peptide, BETA-N Blocking Peptide, FLJ46002 Blocking Peptide, POL-KAPPA Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW |
|---|---|
| Molecular Weight | 63 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | POLL is a repair polymerase.It is involved in base excision repair (BER) responsible for repair of lesions that give rise to abasic (AP) sites in DNA. Has both DNA polymerase and terminal transferase activities. Has a 5'-deoxyribose-5-phosphate lyase (dRP lyase) activity. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product