POLM antibody (70R-5619)

Rabbit polyclonal POLM antibody

Synonyms Polyclonal POLM antibody, Anti-POLM antibody, Tdt-N antibody, Polymerase (DNA directed) mu antibody
Cross Reactivity Human
Applications WB
Immunogen POLM antibody was raised using a synthetic peptide corresponding to a region with amino acids LRRFSRKEKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRN
Assay Information POLM Blocking Peptide, catalog no. 33R-5383, is also available for use as a blocking control in assays to test for specificity of this POLM antibody

Images

Western Blot analysis using POLM antibody (70R-5619)

POLM antibody (70R-5619) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POLM antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance POLM seems to act as an Ig mutase which is responsible for immunoglobulin (Ig) gene hypermutation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using POLM antibody (70R-5619) | POLM antibody (70R-5619) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors