PON1 Blocking Peptide (33R-1504)

A synthetic peptide for use as a blocking control in assays to test for specificity of PON1 antibody, catalog no. 70R-5362

Synonyms PON1 control peptide, PON1 antibody Blocking Peptide, Anti-PON1 Blocking Peptide, Paraoxonase 1 Blocking Peptide, ESA Blocking Peptide, PON Blocking Peptide, PON1, PON-1, PON 1, PON-1 Blocking Peptide, PON 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKA
Molecular Weight 39 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PON1 hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. It is capable of hydrolyzing a broad spectrum of organophosphate substrates and a number of aromatic carboxylic acid esters. It may mediate an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors