PON1 Blocking Peptide (33R-1504)
A synthetic peptide for use as a blocking control in assays to test for specificity of PON1 antibody, catalog no. 70R-5362
Overview
Overview
| Synonyms | PON1 control peptide, PON1 antibody Blocking Peptide, Anti-PON1 Blocking Peptide, Paraoxonase 1 Blocking Peptide, ESA Blocking Peptide, PON Blocking Peptide, PON1, PON-1, PON 1, PON-1 Blocking Peptide, PON 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | ASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKA |
|---|---|
| Molecular Weight | 39 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PON1 hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. It is capable of hydrolyzing a broad spectrum of organophosphate substrates and a number of aromatic carboxylic acid esters. It may mediate an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product