PON3 antibody (70R-6930)
Rabbit polyclonal PON3 antibody raised against the middle region of PON3
Overview
Overview
| Synonyms | Polyclonal PON3 antibody, Anti-PON3 antibody, PON3, PON 3 antibody, PON-3, Paraoxonase 3 antibody, PON-3 antibody, PON 3 |
|---|---|
| Specificity | PON3 antibody was raised against the middle region of PON3 |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | PON3 antibody was raised using the middle region of PON3 corresponding to a region with amino acids FKFEEQQRSLVYLKTIKHELLKSVNDIVVLGPEQFYATRDHYFTNSLLSF |
| Assay Information | PON3 Blocking Peptide, catalog no. 33R-2947, is also available for use as a blocking control in assays to test for specificity of this PON3 antibody |
Images
Western Blot analysis using PON3 antibody (70R-6930)
PON3 antibody (70R-6930) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 39 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene is a member of the paraoxonase family and lies in a cluster on chromosome 7 with the other two family members. The encoded protein is secreted into the bloodstream and associates with high-density lipoprotein (HDL). |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product