PON3 antibody (70R-6930)

Rabbit polyclonal PON3 antibody raised against the middle region of PON3

Synonyms Polyclonal PON3 antibody, Anti-PON3 antibody, PON3, PON 3 antibody, PON-3, Paraoxonase 3 antibody, PON-3 antibody, PON 3
Specificity PON3 antibody was raised against the middle region of PON3
Cross Reactivity Human
Applications WB
Immunogen PON3 antibody was raised using the middle region of PON3 corresponding to a region with amino acids FKFEEQQRSLVYLKTIKHELLKSVNDIVVLGPEQFYATRDHYFTNSLLSF
Assay Information PON3 Blocking Peptide, catalog no. 33R-2947, is also available for use as a blocking control in assays to test for specificity of this PON3 antibody

Images

Western Blot analysis using PON3 antibody (70R-6930)

PON3 antibody (70R-6930) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the paraoxonase family and lies in a cluster on chromosome 7 with the other two family members. The encoded protein is secreted into the bloodstream and associates with high-density lipoprotein (HDL).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PON3 antibody (70R-6930) | PON3 antibody (70R-6930) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors