PORCN Blocking Peptide (33R-1079)

A synthetic peptide for use as a blocking control in assays to test for specificity of PORCN antibody, catalog no. 70R-6584

Synonyms PORCN control peptide, PORCN antibody Blocking Peptide, Anti-PORCN Blocking Peptide, Porcupine Homolog Blocking Peptide, DHOF Blocking Peptide, FODH Blocking Peptide, MG61 Blocking Peptide, MGC29687 Blocking Peptide, PORC Blocking Peptide, PPN Blocking Peptide, por Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQLHMVWVVLLSLLCYLVLF
Molecular Weight 51 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PORCN belongs to the evolutionarily conserved porcupine (Porc) gene family. Genes of the Porc family encode endoplasmic reticulum proteins with multiple transmembrane domains. Porcupine proteins are involved in the processing of Wnt (wingless and int homologue) proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors