PORCN Blocking Peptide (33R-1079)
A synthetic peptide for use as a blocking control in assays to test for specificity of PORCN antibody, catalog no. 70R-6584
Overview
Overview
| Synonyms | PORCN control peptide, PORCN antibody Blocking Peptide, Anti-PORCN Blocking Peptide, Porcupine Homolog Blocking Peptide, DHOF Blocking Peptide, FODH Blocking Peptide, MG61 Blocking Peptide, MGC29687 Blocking Peptide, PORC Blocking Peptide, PPN Blocking Peptide, por Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | ACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQLHMVWVVLLSLLCYLVLF |
|---|---|
| Molecular Weight | 51 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PORCN belongs to the evolutionarily conserved porcupine (Porc) gene family. Genes of the Porc family encode endoplasmic reticulum proteins with multiple transmembrane domains. Porcupine proteins are involved in the processing of Wnt (wingless and int homologue) proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product