PPAP2A antibody (70R-1659)

Rabbit polyclonal PPAP2A antibody raised against the N terminal of PPAP2A

Synonyms Polyclonal PPAP2A antibody, Anti-PPAP2A antibody, PPAPA 2 antibody, Phosphatidic Acid Phosphatase Type 2A antibody, PAP2a2 antibody, PPAPA-2, PAP2alpha2 antibody, PPAP2A, LPP1 antibody, PAPalpha1 antibody, PAP2 antibody, PAP-2a antibody, PPAPA-2 antibody, PPAPA 2, LLP1a antibody
Specificity PPAP2A antibody was raised against the N terminal of PPAP2A
Cross Reactivity Human
Applications IHC, WB
Immunogen PPAP2A antibody was raised using the N terminal of PPAP2A corresponding to a region with amino acids QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV
Assay Information PPAP2A Blocking Peptide, catalog no. 33R-7596, is also available for use as a blocking control in assays to test for specificity of this PPAP2A antibody


Immunohistochemical staining using PPAP2A antibody (70R-1659)

PPAP2A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PPAP2A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPAP2A is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is an integral membrane glycoprotein, and has been shown to be a surface enzyme that plays an active role in the hydrolysis and uptake of lipids from extracellular space.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using PPAP2A antibody (70R-1659) | PPAP2A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using PPAP2A antibody (70R-1659) | PPAP2A antibody (70R-1659) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors