PPIA antibody (70R-1077)

Rabbit polyclonal PPIA antibody

Synonyms Polyclonal PPIA antibody, Anti-PPIA antibody, CYPA antibody, MGC23397 antibody, CYPH antibody, Peptidylprolyl Isomerase A antibody, MGC12404 antibody, MGC117158 antibody, Cyclophilin A antibody
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen PPIA antibody was raised using a synthetic peptide corresponding to a region with amino acids TAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Assay Information PPIA Blocking Peptide, catalog no. 33R-8977, is also available for use as a blocking control in assays to test for specificity of this PPIA antibody

Images

Western Blot analysis using PPIA antibody (70R-1077)

PPIA antibody (70R-1077) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PPIA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPIA is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. PPIA is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PPIA antibody (70R-1077) | PPIA antibody (70R-1077) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors