PPIH antibody (70R-3818)

Rabbit polyclonal PPIH antibody

Synonyms Polyclonal PPIH antibody, Anti-PPIH antibody, USA-CYP antibody, CYP-20 antibody, Cyclophilin H antibody, MGC5016 antibody, SnuCyp-20 antibody, Peptidylprolyl Isomerase H antibody, CYPH antibody
Cross Reactivity Human
Applications WB
Immunogen PPIH antibody was raised using a synthetic peptide corresponding to a region with amino acids DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN
Assay Information PPIH Blocking Peptide, catalog no. 33R-1933, is also available for use as a blocking control in assays to test for specificity of this PPIH antibody


Western Blot analysis using PPIH antibody (70R-3818)

PPIH antibody (70R-3818) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPIH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PPIH antibody (70R-3818) | PPIH antibody (70R-3818) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors