PPIL3 Blocking Peptide (33R-6948)

A synthetic peptide for use as a blocking control in assays to test for specificity of PPIL3 antibody, catalog no. 70R-2932

Synonyms PPIL3 control peptide, PPIL3 antibody Blocking Peptide, Anti-PPIL3 Blocking Peptide, Peptidylprolyl Isomerase Blocking Peptide, Cyclophilin-Like 3 Blocking Peptide, CYPJ Blocking Peptide, PPIL3, PPIL-3, PPIL 3, PPIL-3 Blocking Peptide, PPIL 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVR
Molecular Weight 18 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolylimide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events. Alternative splicing results in multiple transcript variants.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors