PPIL3 Blocking Peptide (33R-6948)
A synthetic peptide for use as a blocking control in assays to test for specificity of PPIL3 antibody, catalog no. 70R-2932
Overview
Overview
| Synonyms | PPIL3 control peptide, PPIL3 antibody Blocking Peptide, Anti-PPIL3 Blocking Peptide, Peptidylprolyl Isomerase Blocking Peptide, Cyclophilin-Like 3 Blocking Peptide, CYPJ Blocking Peptide, PPIL3, PPIL-3, PPIL 3, PPIL-3 Blocking Peptide, PPIL 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVR |
|---|---|
| Molecular Weight | 18 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolylimide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events. Alternative splicing results in multiple transcript variants. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product