PPM1B antibody (70R-2682)

Rabbit polyclonal PPM1B antibody

Synonyms Polyclonal PPM1B antibody, Anti-PPM1B antibody, Protein Phosphatase 1B antibody, PPM-1 antibody, PPM 1, MGC21657 antibody, PP2C-beta-X antibody, PPM1, PPC2BETAX antibody, PPM-1, PP2CB antibody, PPM 1 antibody, PP2CBETA antibody
Cross Reactivity Human,Rat
Applications WB
Immunogen PPM1B antibody was raised using a synthetic peptide corresponding to a region with amino acids EIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLN
Assay Information PPM1B Blocking Peptide, catalog no. 33R-2480, is also available for use as a blocking control in assays to test for specificity of this PPM1B antibody


Western Blot analysis using PPM1B antibody (70R-2682)

PPM1B antibody (70R-2682) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPM1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PPM1B antibody (70R-2682) | PPM1B antibody (70R-2682) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors