PPM1M Blocking Peptide (33R-8149)

A synthetic peptide for use as a blocking control in assays to test for specificity of PPM1M antibody, catalog no. 70R-3594

Synonyms PPM1M control peptide, PPM1M antibody Blocking Peptide, Anti-PPM1M Blocking Peptide, Protein Phosphatase 1M Blocking Peptide, Pp2C Domain Containing Blocking Peptide, FLJ32332 Blocking Peptide, PP2C-eta Blocking Peptide, PP2CE Blocking Peptide, PP2Ceta Blocking Peptide, PPM1, PPM-1, PPM 1, PPM-1 Blocking Peptide, PPM 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKYPLIHGQGRQARLLGTL
Molecular Weight 27 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPM1M belongs to the PP2C family. It contains 1 PP2C-like domain. The exact function of PPM1M is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors