PPM1M Blocking Peptide (33R-8149)
A synthetic peptide for use as a blocking control in assays to test for specificity of PPM1M antibody, catalog no. 70R-3594
Overview
Overview
| Synonyms | PPM1M control peptide, PPM1M antibody Blocking Peptide, Anti-PPM1M Blocking Peptide, Protein Phosphatase 1M Blocking Peptide, Pp2C Domain Containing Blocking Peptide, FLJ32332 Blocking Peptide, PP2C-eta Blocking Peptide, PP2CE Blocking Peptide, PP2Ceta Blocking Peptide, PPM1, PPM-1, PPM 1, PPM-1 Blocking Peptide, PPM 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKYPLIHGQGRQARLLGTL |
|---|---|
| Molecular Weight | 27 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PPM1M belongs to the PP2C family. It contains 1 PP2C-like domain. The exact function of PPM1M is not known. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product