PPP1CA antibody (70R-2013)

Rabbit polyclonal PPP1CA antibody raised against the N terminal of PPP1CA

Synonyms Polyclonal PPP1CA antibody, Anti-PPP1CA antibody, PP-1A antibody, PPP1CA, PPP1A antibody, Protein Phosphatase 1 Catalytic Subunit Alpha Isoform antibody, MGC15877 antibody, PPPCA-1, PPPCA 1 antibody, PPPCA 1, MGC1674 antibody, PPPCA-1 antibody
Specificity PPP1CA antibody was raised against the N terminal of PPP1CA
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen PPP1CA antibody was raised using the N terminal of PPP1CA corresponding to a region with amino acids MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC
Assay Information PPP1CA Blocking Peptide, catalog no. 33R-6411, is also available for use as a blocking control in assays to test for specificity of this PPP1CA antibody


Western Blot analysis using PPP1CA antibody (70R-2013)

PPP1CA antibody (70R-2013) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPP1CA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPP1CA is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Increased PP1 activity has been observed in the end stage of heart failure. Studies in both human and mice suggest that PP1 is an important regulator of cardiac function. Mouse studies also suggest that PP1 functions as a suppressor of learning and memory.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PPP1CA antibody (70R-2013) | PPP1CA antibody (70R-2013) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors