PPP1R15B Blocking Peptide (33R-8420)
A synthetic peptide for use as a blocking control in assays to test for specificity of PPP1R15B antibody, catalog no. 70R-10145
Overview
Overview
| Synonyms | PPP1R15B control peptide, PPP1R15B antibody Blocking Peptide, Anti-PPP1R15B Blocking Peptide, protein phosphatase 1, regulatory, inhibitor subunit 15B Blocking Peptide, CREP Blocking Peptide, FLJ14744 Blocking Peptide, PPP1R15B, PPPR5B-1, PPPR5B 1, PPPR5B-1 Blocking Peptide, PPPR5B 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SFCSVDPYNPQNFTATIQTAARIVPEEPSDSEKDLSGKSDLENSSQSGSL |
|---|---|
| Molecular Weight | 79 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PPP1R15B promotes dephosphorylation of the transcription initiation factor EIF2-alphasthrough recruitment of protein phosphatase-1 (PP1) catalytic subunits. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product