PPP1R15B Blocking Peptide (33R-8420)

A synthetic peptide for use as a blocking control in assays to test for specificity of PPP1R15B antibody, catalog no. 70R-10145

Synonyms PPP1R15B control peptide, PPP1R15B antibody Blocking Peptide, Anti-PPP1R15B Blocking Peptide, protein phosphatase 1, regulatory, inhibitor subunit 15B Blocking Peptide, CREP Blocking Peptide, FLJ14744 Blocking Peptide, PPP1R15B, PPPR5B-1, PPPR5B 1, PPPR5B-1 Blocking Peptide, PPPR5B 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SFCSVDPYNPQNFTATIQTAARIVPEEPSDSEKDLSGKSDLENSSQSGSL
Molecular Weight 79 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPP1R15B promotes dephosphorylation of the transcription initiation factor EIF2-alphasthrough recruitment of protein phosphatase-1 (PP1) catalytic subunits.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors