PPP1R8 antibody (70R-4733)

Rabbit polyclonal PPP1R8 antibody

Synonyms Polyclonal PPP1R8 antibody, Anti-PPP1R8 antibody, PPPR8-1, ARD1 antibody, NIPP1 antibody, PPPR8-1 antibody, PPPR8 1, NIPP-1 antibody, PRO2047 antibody, PPPR8 1 antibody, Protein Phosphatase 1 Regulatory Inhibitor Subunit 8 antibody, PPP1R8, ARD-1 antibody
Cross Reactivity Human
Applications WB
Immunogen PPP1R8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLY
Assay Information PPP1R8 Blocking Peptide, catalog no. 33R-9473, is also available for use as a blocking control in assays to test for specificity of this PPP1R8 antibody


Western Blot analysis using PPP1R8 antibody (70R-4733)

PPP1R8 antibody (70R-4733) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPP1R8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PPP1R8 antibody (70R-4733) | PPP1R8 antibody (70R-4733) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors