PPP2R1A antibody (70R-2215)

Rabbit polyclonal PPP2R1A antibody

Synonyms Polyclonal PPP2R1A antibody, Anti-PPP2R1A antibody, MGC786 antibody, PPPR-2 antibody, PPPR 2, PPP2R, PPPR-2, Protein Phosphatase 2 regulatory subunit A alpha isoform antibody, PR65A antibody, PPPR 2 antibody
Cross Reactivity Human
Applications WB
Immunogen PPP2R1A antibody was raised using a synthetic peptide corresponding to a region with amino acids NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL
Assay Information PPP2R1A Blocking Peptide, catalog no. 33R-6908, is also available for use as a blocking control in assays to test for specificity of this PPP2R1A antibody


Western Blot analysis using PPP2R1A antibody (70R-2215)

PPP2R1A antibody (70R-2215) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPP2R1A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPP2R1A is a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PPP2R1A antibody (70R-2215) | PPP2R1A antibody (70R-2215) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors