Ppp2r2c Blocking Peptide (33R-9839)
A synthetic peptide for use as a blocking control in assays to test for specificity of Ppp2r2c antibody, catalog no. 70R-9541
Overview
Overview
| Synonyms | Ppp2r2c control peptide, Ppp2r2c antibody Blocking Peptide, Anti-Ppp2r2c Blocking Peptide, protein phosphatase 2, formerly 2A, regulatory subunit B, PR 52, gamma isoform Blocking Peptide, 6330548O06Rik Blocking Peptide, IMYPNO Blocking Peptide, IMYPNO1 Blocking Peptide, PR52 Blocking Peptide, Ppp2r2c, Ppprc-2, Ppprc 2, Ppprc-2 Blocking Peptide, Ppprc 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | VTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVY |
|---|---|
| Molecular Weight | 49 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product