Ppp2r2c Blocking Peptide (33R-9839)

A synthetic peptide for use as a blocking control in assays to test for specificity of Ppp2r2c antibody, catalog no. 70R-9541

Synonyms Ppp2r2c control peptide, Ppp2r2c antibody Blocking Peptide, Anti-Ppp2r2c Blocking Peptide, protein phosphatase 2, formerly 2A, regulatory subunit B, PR 52, gamma isoform Blocking Peptide, 6330548O06Rik Blocking Peptide, IMYPNO Blocking Peptide, IMYPNO1 Blocking Peptide, PR52 Blocking Peptide, Ppp2r2c, Ppprc-2, Ppprc 2, Ppprc-2 Blocking Peptide, Ppprc 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVY
Molecular Weight 49 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors