PPP2R3A antibody (70R-2338)

Rabbit polyclonal PPP2R3A antibody

Synonyms Polyclonal PPP2R3A antibody, Anti-PPP2R3A antibody, Protein Phosphatase 2 regulatory subunit B alpha isoform antibody, PPP2R3 antibody, PR130 antibody, PPPR 2 antibody, PPPR-2, PPP2R, PPPR 2, PPPR-2 antibody, PR72 antibody
Cross Reactivity Human
Applications WB
Immunogen PPP2R3A antibody was raised using a synthetic peptide corresponding to a region with amino acids SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD
Assay Information PPP2R3A Blocking Peptide, catalog no. 33R-8853, is also available for use as a blocking control in assays to test for specificity of this PPP2R3A antibody


Western blot analysis using PPP2R3A antibody (70R-2338)

Recommended PPP2R3A Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 130 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPP2R3A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using PPP2R3A antibody (70R-2338) | Recommended PPP2R3A Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors