PPP2R5C antibody (70R-2037)

Rabbit polyclonal PPP2R5C antibody raised against the middle region of PPP2R5C

Synonyms Polyclonal PPP2R5C antibody, Anti-PPP2R5C antibody, PPPR-2, PPPR 2 antibody, PPP2R, Protein Phosphatase 2 Regulatory Subunit B Gamma Isoform antibody, MGC23064 antibody, PPPR 2, PR61G antibody, B56G antibody, PPPR-2 antibody
Specificity PPP2R5C antibody was raised against the middle region of PPP2R5C
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PPP2R5C antibody was raised using the middle region of PPP2R5C corresponding to a region with amino acids RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGK
Assay Information PPP2R5C Blocking Peptide, catalog no. 33R-7903, is also available for use as a blocking control in assays to test for specificity of this PPP2R5C antibody


Western Blot analysis using PPP2R5C antibody (70R-2037)

PPP2R5C antibody (70R-2037) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPP2R5C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common het

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PPP2R5C antibody (70R-2037) | PPP2R5C antibody (70R-2037) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors