PRD antibody (70R-3199)

Rabbit polyclonal PRD antibody raised against the middle region of PRD

Synonyms Polyclonal PRD antibody, Anti-PRD antibody, pr antibody, Prd antibody, CG6716 antibody, Primary Retinal Dysplasia antibody, Dmel_CG6716 antibody
Specificity PRD antibody was raised against the middle region of PRD
Cross Reactivity Drosophila
Applications WB
Immunogen PRD antibody was raised using the middle region of PRD corresponding to a region with amino acids MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRL
Assay Information PRD Blocking Peptide, catalog no. 33R-6573, is also available for use as a blocking control in assays to test for specificity of this PRD antibody

Images

Western blot analysis using PRD antibody (70R-3199)

Recommended prd Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Prd is a pair-rule protein expressed in a segmentally repeating pattern to define the polarity of embryonic segments.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using PRD antibody (70R-3199) | Recommended prd Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors