PRDM15 antibody (70R-1966)

Rabbit polyclonal PRDM15 antibody raised against the middle region of PRDM15

Synonyms Polyclonal PRDM15 antibody, Anti-PRDM15 antibody, ZNF298 antibody, PRDM 15, PRDM-15 antibody, PRDM15, PRDM-15, Pr Domain Containing 15 antibody, PRDM 15 antibody, PFM15 antibody, C21orf83 antibody
Specificity PRDM15 antibody was raised against the middle region of PRDM15
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PRDM15 antibody was raised using the middle region of PRDM15 corresponding to a region with amino acids LCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDASSIGIVQP
Assay Information PRDM15 Blocking Peptide, catalog no. 33R-4819, is also available for use as a blocking control in assays to test for specificity of this PRDM15 antibody


Western Blot analysis using PRDM15 antibody (70R-1966)

PRDM15 antibody (70R-1966) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 134 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRDM15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRDM15 may be involved in transcriptional regulation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRDM15 antibody (70R-1966) | PRDM15 antibody (70R-1966) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors