PRDX1 antibody (70R-2253)

Rabbit polyclonal PRDX1 antibody raised against the N terminal of PRDX1

Synonyms Polyclonal PRDX1 antibody, Anti-PRDX1 antibody, Peroxiredoxin 1 antibody, TDPX2 antibody, MSP23 antibody, PRDX-1, PAG antibody, PRX1 antibody, NKEFA antibody, PRDX 1 antibody, PRDX-1 antibody, PRDX1, PAGB antibody, PAGA antibody, PRDX 1
Specificity PRDX1 antibody was raised against the N terminal of PRDX1
Cross Reactivity Human,Rat
Applications WB
Immunogen PRDX1 antibody was raised using the N terminal of PRDX1 corresponding to a region with amino acids SSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFV
Assay Information PRDX1 Blocking Peptide, catalog no. 33R-8807, is also available for use as a blocking control in assays to test for specificity of this PRDX1 antibody

Images

Western Blot analysis using PRDX1 antibody (70R-2253)

PRDX1 antibody (70R-2253) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRDX1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRDX1 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. It may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRDX1 antibody (70R-2253) | PRDX1 antibody (70R-2253) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors