PRDX6 antibody (70R-1201)

Rabbit polyclonal PRDX6 antibody raised against the middle region of PRDX6

Synonyms Polyclonal PRDX6 antibody, Anti-PRDX6 antibody, aiPLA2 antibody, PRDX 6 antibody, 1-Cys antibody, p29 antibody, AOP2 antibody, PRX antibody, PRDX6, PRDX-6, Peroxiredoxin 6 antibody, KIAA0106 antibody, PRDX 6, NSGPx antibody, PRDX-6 antibody, MGC46173 antibody
Specificity PRDX6 antibody was raised against the middle region of PRDX6
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PRDX6 antibody was raised using the middle region of PRDX6 corresponding to a region with amino acids ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD
Assay Information PRDX6 Blocking Peptide, catalog no. 33R-1499, is also available for use as a blocking control in assays to test for specificity of this PRDX6 antibody

Images

Western Blot analysis using PRDX6 antibody (70R-1201)

PRDX6 antibody (70R-1201) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PRDX6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRDX6 is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRDX6 antibody (70R-1201) | PRDX6 antibody (70R-1201) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors