PRKAB1 antibody (70R-3695)

Rabbit polyclonal PRKAB1 antibody raised against the N terminal of PRKAB1

Synonyms Polyclonal PRKAB1 antibody, Anti-PRKAB1 antibody, HAMPKb antibody, AMPK antibody, MGC17785 antibody, Protein Kinase Amp-Activated Beta 1 Non-Catalytic Subunit antibody
Specificity PRKAB1 antibody was raised against the N terminal of PRKAB1
Cross Reactivity Human,Mouse
Applications WB
Immunogen PRKAB1 antibody was raised using the N terminal of PRKAB1 corresponding to a region with amino acids KILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRW
Assay Information PRKAB1 Blocking Peptide, catalog no. 33R-4439, is also available for use as a blocking control in assays to test for specificity of this PRKAB1 antibody


Western Blot analysis using PRKAB1 antibody (70R-3695)

PRKAB1 antibody (70R-3695) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKAB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRKAB1 antibody (70R-3695) | PRKAB1 antibody (70R-3695) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors