PRKAB2 antibody (70R-3694)

Rabbit polyclonal PRKAB2 antibody raised against the middle region of PRKAB2

Synonyms Polyclonal PRKAB2 antibody, Anti-PRKAB2 antibody, Protein Kinase Amp-Activated Beta 2 Non-Catalytic Subunit antibody, MGC61468 antibody
Specificity PRKAB2 antibody was raised against the middle region of PRKAB2
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen PRKAB2 antibody was raised using the middle region of PRKAB2 corresponding to a region with amino acids RDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPA
Assay Information PRKAB2 Blocking Peptide, catalog no. 33R-7854, is also available for use as a blocking control in assays to test for specificity of this PRKAB2 antibody


Western Blot analysis using PRKAB2 antibody (70R-3694)

PRKAB2 antibody (70R-3694) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKAB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRKAB2 antibody (70R-3694) | PRKAB2 antibody (70R-3694) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors