PRKACB antibody (70R-2704)

Rabbit polyclonal PRKACB antibody raised against the middle region of PRKACB

Synonyms Polyclonal PRKACB antibody, Anti-PRKACB antibody, MGC41879 antibody, MGC9320 antibody, DKFZp781I2452 antibody, PKACB antibody, Protein Kinase Camp-Dependent Catalytic Beta antibody
Specificity PRKACB antibody was raised against the middle region of PRKACB
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PRKACB antibody was raised using the middle region of PRKACB corresponding to a region with amino acids NGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDI
Assay Information PRKACB Blocking Peptide, catalog no. 33R-6712, is also available for use as a blocking control in assays to test for specificity of this PRKACB antibody


Western Blot analysis using PRKACB antibody (70R-2704)

PRKACB antibody (70R-2704) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKACB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRKACB antibody (70R-2704) | PRKACB antibody (70R-2704) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors