PRKAR1B antibody (70R-2705)

Rabbit polyclonal PRKAR1B antibody raised against the middle region of PRKAR1B

Synonyms Polyclonal PRKAR1B antibody, Anti-PRKAR1B antibody, Protein Kinase Camp-Dependent Regulatory Type I Beta antibody, PRKAR1 antibody
Specificity PRKAR1B antibody was raised against the middle region of PRKAR1B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PRKAR1B antibody was raised using the middle region of PRKAR1B corresponding to a region with amino acids LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT
Assay Information PRKAR1B Blocking Peptide, catalog no. 33R-5240, is also available for use as a blocking control in assays to test for specificity of this PRKAR1B antibody


Western Blot analysis using PRKAR1B antibody (70R-2705)

PRKAR1B antibody (70R-2705) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKAR1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRKAR1B antibody (70R-2705) | PRKAR1B antibody (70R-2705) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors