PRKCB1 antibody (70R-5848)

Rabbit polyclonal PRKCB1 antibody raised against the N terminal of PRKCB1

Synonyms Polyclonal PRKCB1 antibody, Anti-PRKCB1 antibody, PRKCB 1 antibody, Protein Kinase C Beta 1 antibody, PRKCB antibody, PRKCB1, PKCB antibody, PKC-beta antibody, PRKCB-1, PRKCB2 antibody, PRKCB 1, PRKCB-1 antibody, MGC41878 antibody
Specificity PRKCB1 antibody was raised against the N terminal of PRKCB1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PRKCB1 antibody was raised using the N terminal of PRKCB1 corresponding to a region with amino acids MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC
Assay Information PRKCB1 Blocking Peptide, catalog no. 33R-5625, is also available for use as a blocking control in assays to test for specificity of this PRKCB1 antibody

Images

Western Blot analysis using PRKCB1 antibody (70R-5848)

PRKCB1 antibody (70R-5848) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKCB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRKCB1 antibody (70R-5848) | PRKCB1 antibody (70R-5848) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors