PRKCG antibody (70R-5851)

Rabbit polyclonal PRKCG antibody raised against the middle region of PRKCG

Synonyms Polyclonal PRKCG antibody, Anti-PRKCG antibody, PKCG antibody, PKC-gamma antibody, MGC57564 antibody, PKCC antibody, SCA14 antibody, Protein Kinase C Gamma antibody
Specificity PRKCG antibody was raised against the middle region of PRKCG
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PRKCG antibody was raised using the middle region of PRKCG corresponding to a region with amino acids WSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKG
Assay Information PRKCG Blocking Peptide, catalog no. 33R-10011, is also available for use as a blocking control in assays to test for specificity of this PRKCG antibody

Images

Western Blot analysis using PRKCG antibody (70R-5851)

PRKCG antibody (70R-5851) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 78 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKCG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRKCG antibody (70R-5851) | PRKCG antibody (70R-5851) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors