PRKRIR antibody (70R-2707)

Rabbit polyclonal PRKRIR antibody

Synonyms Polyclonal PRKRIR antibody, Anti-PRKRIR antibody, Protein-Kinase Interferon-Inducible Double Stranded Rna Dependent Inhibitor Repressor Of antibody, P52rIPK antibody, MGC102750 antibody, P58 Repressor antibody, DAP4 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PRKRIR antibody was raised using a synthetic peptide corresponding to a region with amino acids VENCRRADLEDKTPDQLNKHYRLCAKHFETSMICRTSPYRTVLRDNAIPT
Assay Information PRKRIR Blocking Peptide, catalog no. 33R-9506, is also available for use as a blocking control in assays to test for specificity of this PRKRIR antibody


Western Blot analysis using PRKRIR antibody (70R-2707)

PRKRIR antibody (70R-2707) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 88 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKRIR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRKRIR is upstream regulator of interferon-induced serine/threonine protein kinase R (PKR). PRKRIR may block the PKR-inhibitory function of P58IPK, resulting in restoration of kinase activity and suppression of cell growth.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRKRIR antibody (70R-2707) | PRKRIR antibody (70R-2707) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors