PRMT2 antibody (70R-2062)

Rabbit polyclonal PRMT2 antibody raised against the N terminal of PRMT2

Synonyms Polyclonal PRMT2 antibody, Anti-PRMT2 antibody, PRMT 2, Protein Arginine Methyltransferase 2 antibody, HRMT1L1 antibody, PRMT2, PRMT-2 antibody, PRMT 2 antibody, MGC111373 antibody, PRMT-2
Specificity PRMT2 antibody was raised against the N terminal of PRMT2
Cross Reactivity Human
Applications WB
Immunogen PRMT2 antibody was raised using the N terminal of PRMT2 corresponding to a region with amino acids ERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQP
Assay Information PRMT2 Blocking Peptide, catalog no. 33R-2686, is also available for use as a blocking control in assays to test for specificity of this PRMT2 antibody


Western Blot analysis using PRMT2 antibody (70R-2062)

PRMT2 antibody (70R-2062) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRMT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein arginine methyltransferases (PRMTs) include a family of proteins with related putative methyltransferase domains that modify chromatin and regulate cellular transcription. PRMT2 inhibits NF-kappaB-dependent transcription and promotes apoptosis and it exerts this effect by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding. PRMT2 also rendered cells susceptible to apoptosis by cytokines or cytotoxic drugs, likely due to its effects on NF-kappaB.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRMT2 antibody (70R-2062) | PRMT2 antibody (70R-2062) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors