Protein S antibody (70R-6073)

Rabbit polyclonal Protein S antibody

Synonyms Polyclonal Protein S antibody, Anti-Protein S antibody, PS22 antibody, PS23 antibody, PROS1 antibody, PS 26 antibody, PS21 antibody, PS24 antibody, PROS antibody, PS25 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen Protein S antibody was raised using a synthetic peptide corresponding to a region with amino acids MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL
Assay Information Protein S Blocking Peptide, catalog no. 33R-5808, is also available for use as a blocking control in assays to test for specificity of this Protein S antibody

Images

Western Blot analysis using Protein S antibody (70R-6073)

Protein S antibody (70R-6073) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PROS1 is an anticoagulant plasma protein; it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Protein S antibody (70R-6073) | Protein S antibody (70R-6073) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €282.21
Size: 50 ug
OR
Shipping
View Our Distributors