Protein S antibody (70R-6073)
Rabbit polyclonal Protein S antibody
Overview
Overview
| Synonyms | Polyclonal Protein S antibody, Anti-Protein S antibody, PS22 antibody, PS23 antibody, PROS1 antibody, PS 26 antibody, PS21 antibody, PS24 antibody, PROS antibody, PS25 antibody |
|---|---|
| Cross Reactivity | Human,Mouse |
| Applications | WB |
| Immunogen | Protein S antibody was raised using a synthetic peptide corresponding to a region with amino acids MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL |
| Assay Information | Protein S Blocking Peptide, catalog no. 33R-5808, is also available for use as a blocking control in assays to test for specificity of this Protein S antibody |
Images
Western Blot analysis using Protein S antibody (70R-6073)
Protein S antibody (70R-6073) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 71 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PROS1 is an anticoagulant plasma protein; it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product