PRPF19 antibody (70R-1048)

Rabbit polyclonal PRPF19 antibody

Synonyms Polyclonal PRPF19 antibody, Anti-PRPF19 antibody, NMP200 antibody, PRPF 19, PRPF-19 antibody, Prp19/Pso4 Pre-mRNA Processing Factor 19 Homolog antibody, UBOX4 antibody, PRPF 19 antibody, PSO4 antibody, PRP19 antibody, PRPF19, hPSO4 antibody, PRPF-19
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen PRPF19 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHP
Assay Information PRPF19 Blocking Peptide, catalog no. 33R-9720, is also available for use as a blocking control in assays to test for specificity of this PRPF19 antibody

Images

Western Blot analysis using PRPF19 antibody (70R-1048)

PRPF19 antibody (70R-1048) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PRPF19 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRPF19 plays a role in DNA double-strand break (DSB) repair and pre-mRNA splicing reaction. It binds double-stranded DNA in a sequence-nonspecific manner. PRPF19 acts as a structural component of the nuclear framework. It may also serve as a support for spliceosome binding and activity. It is essential for spliceosome assembly in a oligomerization-dependent manner and might also be important for spliceosome stability. It also may have E3 ubiquitin ligase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRPF19 antibody (70R-1048) | PRPF19 antibody (70R-1048) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors