PRPF6 antibody (70R-1449)

Rabbit polyclonal PRPF6 antibody

Synonyms Polyclonal PRPF6 antibody, Anti-PRPF6 antibody, PRPF 6 antibody, ANT-1 antibody, PRPF-6, PRPF-6 antibody, Prp6 Pre-mRNA Processing Factor 6 Homolog antibody, TOM antibody, PRPF6, PRPF 6
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications WB
Immunogen PRPF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE
Assay Information PRPF6 Blocking Peptide, catalog no. 33R-7111, is also available for use as a blocking control in assays to test for specificity of this PRPF6 antibody


Western Blot analysis using PRPF6 antibody (70R-1449)

PRPF6 antibody (70R-1449) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 104 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PRPF6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRPF6 appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. PRPF6 also can bind androgen receptor, providing a link between transcriptional activation and splicing.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRPF6 antibody (70R-1449) | PRPF6 antibody (70R-1449) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors